PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DL_230E818AD.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 339aa    MW: 36982.4 Da    PI: 7.0125
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DL_230E818AD.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.52.1e-11140198563
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                            kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l+ l+   + l+se+
  Traes_5DL_230E818AD.2 140 KRAKRIWANRQSAARSKERKMRYIGELERKVQTLQTEATTLSAQLSLLQRDTSGLTSEN 198
                            9************************************************9999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.6E-17136200IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.909138201IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.95E-11140191No hitNo description
PfamPF001705.3E-10140198IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.8E-10140196No hitNo description
CDDcd147032.55E-23141190No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MPDFPTRNPG HRRAHSEILS LPDDLDLCAP GGGDGPSLSD ENDEELFSMF LDVDKLNSSC  60
GPSSDQAESS SAAAAGGGEA ARAGHVMRPK HQHSQSMDES MSIKAEDLVG APGMEGMSTV  120
EAKKAVSAAK LAELALVDPK RAKRIWANRQ SAARSKERKM RYIGELERKV QTLQTEATTL  180
SAQLSLLQRD TSGLTSENSE LKIRLQNMEQ QVHLQDALND TLKTEVQRLK VATGQMGNGG  240
GMLMNYGGMS QAPHQFGGSQ QMFHSNQSMQ SLLATHQLQQ LQLHQQPQQQ QQPMRPQHHQ  300
QQQQPLHPLQ AQQFQQAARD LKMKGPMWGD GKSPGGGGI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3564330.0AK356433.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1034M13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576732.11e-162PREDICTED: transcription factor RF2a-like
RefseqXP_014758763.11e-162PREDICTED: transcription factor RF2a-like
SwissprotQ69IL41e-143RF2A_ORYSJ; Transcription factor RF2a
TrEMBLW5FR880.0W5FR88_WHEAT; Uncharacterized protein
STRINGMLOC_64781.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-96bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]